Protein Info for GFF4676 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 258 to 290 (33 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 322 to 348 (27 residues), see Phobius details PF01032: FecCD" amino acids 29 to 348 (320 residues), 275.4 bits, see alignment E=2.8e-86

Best Hits

KEGG orthology group: None (inferred from 48% identity to mtp:Mthe_1186)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF4676 Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNVSALQRDIAVLRASRWRVALLAALALLGAALASLSLGVQAQSARSVLTELLSLLPGLD
ALSNPGPAREVLLQLRLPRTVMALVCGAGLAMAGVAMQGITRNPLVSPYTLGISPAAAFG
ASIAILLGWNTLPGTGAYWTVGMAFFAALVCAVGVLGLAALRGVNAIVLVLAGVAFTYLF
GALTATLQFFASEQQLAAIVHWTFGSLNGRSWHEVMVAGGVWLLCAPVLLVHAGALNAFS
AGGDDVAASLGVAVARTRIAVTLAAVLSSAAIVSFTGVIGFVGLVAPHIARLLIGGDHRA
LLPFAALVGALLVLLADMAGRLLFAPVVVPVGIVVAFVGVPLFLHLLLTRRNEMAS