Protein Info for GFF4674 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Prophage Clp protease-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 PF00574: CLP_protease" amino acids 16 to 190 (175 residues), 131 bits, see alignment E=9.2e-42 PF01972: SDH_protease" amino acids 60 to 120 (61 residues), 31.4 bits, see alignment 2e-11 PF25209: Phage_capsid_4" amino acids 469 to 681 (213 residues), 154.9 bits, see alignment E=7.9e-49 PF10124: Mu-like_gpT" amino acids 542 to 616 (75 residues), 21.8 bits, see alignment E=2.3e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM1033)

Predicted SEED Role

"Prophage Clp protease-like protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>GFF4674 Prophage Clp protease-like protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPPVMTAGNGRGEGSSNSWYSIRAAANNTAEVRIYDEIGGWGISARWFAEELAALGQINR
INLHIHSPGGAVLDGIAIYNLLKNHPAQKTVYIDGMACSMASAIAMVGNPIIMPENAMMM
IHKPRGVAGGEAEDIREYADLLDKIESVIIPIYTEKTGKTPEDIAAMLAKETWMSGAECV
SEGFADKLIQPVKAMACIHSKRVEEFEHMPQSIKGMIIAPQGNAGAQPQPQAKAPESQIQ
SQAQSLVTVDENAIRARLQEEQRNRITGIQNVFSLSGDRYASLMAKCIADVDCSLEMAKD
RLLAEMAKGITPTNQLNGPQNRAEFHAGMYTGNGNITGDAVRAAVMARAGYEEAQKDNPY
NCMTLRELARISLVARGTGVSSMNPMQMIGMAFTHSTSDFGNILLDVANKSILQGWQEAP
ETFDAWTKKGQLSDFRIAHRVGMGGFSSLRQVREGAEYKYVTTGDKQATIALATYGELFS
ITRQAIINDDMNMLTDVPMKLGRAAKATIADLVYDVLISNQKLSSDNVALFDKTKHANVL
EKAVMDVASLDKARQLMRMQKEGDRHLNIRPAFVLVPTAMESVSNQVIKSVSVKGADINA
GIINPVKDFATVIAEPRLDDASQSTFYLTAAKGSDTVEVAYLNGVDEPYIDQQEGFTVDG
VTTKVRIDAGVAPVDYRGMVKCTV