Protein Info for GFF4673 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage portal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 TIGR01539: phage portal protein, lambda family" amino acids 31 to 478 (448 residues), 523.1 bits, see alignment E=2.7e-161 PF05136: Phage_portal_2" amino acids 35 to 374 (340 residues), 293.1 bits, see alignment E=1.6e-91

Best Hits

KEGG orthology group: None (inferred from 99% identity to seh:SeHA_C1142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>GFF4673 Phage portal protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNFIDKAISMMSPGWAVSRLRSRAVIKAYEAAIPTRTHKIKRENRNANQLNQIAGKSLRE
QARWFDNNHDLVVGALDKMEERVIGAKGIIVEPQPLTVAGTLNNALAEQIRARWAEWSVS
PDVTGQYTRPVLERLLLRTWLRDGEVFSQMVAGKMPGLEPVAGVPFWLEAMEPDYVPMEQ
TDSTNNLIQGIYFNDWQRPKSYIVCKSWPGFATAMVATKLIDAENMLHLKFTRRLNQARG
VTLLAPVIIRLLDLKEYEDSERLAARISAAFAMFIRRSDAMVQDGDAPDYADKDRDLDIE
PGTILKDLLPGEDIGTIKSDRPNANLESFRMGQLRAVAAGVRGSFSSIARNYDGTYSAQR
QELVEAQEGYAILQDNFIAAVSRPVYRRWLATAITAGVIDVPTDTDMATLFNAVYSGPVM
PWIDPLKEANAWRILIRGGAATESDWVRARGGAPAEVKRRRKAEIDENRKLGLVFDTDPA
HDPGEQDNAGSEDNSGGDKNAAGDDSRERTRGGKQ