Protein Info for GFF4672 in Sphingobium sp. HT1-2

Annotation: N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01869: BcrAD_BadFG" amino acids 5 to 261 (257 residues), 107.6 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 38% identical to GSPK_VIBCH: Glucosamine kinase GspK (gspK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 52% identity to zmn:Za10_0159)

MetaCyc: 38% identical to glucosamine kinase (Vibrio cholerae O1 biovar El Tor str. N16961)
Glucosamine kinase. [EC: 2.7.1.8]

Predicted SEED Role

"N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59)" in subsystem Chitin and N-acetylglucosamine utilization (EC 2.7.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.59 or 2.7.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF4672 N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59) (Sphingobium sp. HT1-2)
MSYFLGIDAGGSNCRARLIDSEGNVIGTGQGGTANARIGLEALYTTLCAVSNQAIAEAGL
SSMQVETIRAGMGIAGISRPGVRDALERFAFPFASVNYGTDAFIANLGAHGGADGAILIL
GTGSIAQVRAGGRDFTIGGYGFPISDEGSGAALGLSAMRHALRALDGRSQATPLSRAVTE
RFDHDTTKAIGWMDKATPKDYGSFAPLVMDYAEADDAIARSIVEDAVQHIERFIETIFER
GASRCTLVGGLADRMQPWLRARTVGRLSPKLGDPLDGALLFASYL