Protein Info for GFF4671 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 54% identity to bpy:Bphyt_6806)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF4671 Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDGDTDTEHSTMTWDVRLRKRLRQGGSQFELDVDFRTAAQRVVIFGPSGAGKTQTLRMIA
GLGTPEEARVVVAGQVLCDTAQGKVATPQERRLAYVFQEYALFPHLTVVQNVAFALRRGW
TNPNKAVRDERVDRWISSFHLESVAGHYPHQISGGQRQRTALARALVTDPRALLLDEPFA
ALDKGLRERLRNELKALQIELQLPMLLITHDDDDVNCLAEQVICIDGGKVVERVRTW