Protein Info for GFF467 in Pseudomonas sp. DMC3

Annotation: Chorismate pyruvate-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF04345: Chor_lyase" amino acids 11 to 180 (170 residues), 173.8 bits, see alignment E=2.5e-55 PF01947: Rv2949c-like" amino acids 32 to 175 (144 residues), 24.5 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 82% identical to UBIC2_PSEPF: Probable chorismate pyruvate-lyase 2 (ubiC2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 82% identity to pfo:Pfl01_5603)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>GFF467 Chorismate pyruvate-lyase (Pseudomonas sp. DMC3)
VQHSNACPAPLWLTQDRLTPRPDPLTLDWLFDEGSLTRRLTRLSEDGFSVSPLFEGWDTL
RADECAALELAEGSEGWVREVYLRGHGEAWVFARSVASRAALQGDGLHMDELGSRSLGEL
LFCDQAFQRRAIEVCRYPEQWLPPAVQAPELWGRRSRFDRGALSVLVAEIFLPSLWDAAR
AHPENC