Protein Info for GFF4668 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tricarboxylate transport membrane protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 42 to 43 (2 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 147 to 186 (40 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 447 (33 residues), see Phobius details amino acids 467 to 490 (24 residues), see Phobius details PF01970: TctA" amino acids 20 to 441 (422 residues), 535.1 bits, see alignment E=5.2e-165

Best Hits

Swiss-Prot: 63% identical to YZ2R_AGRVI: Uncharacterized 52.8 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: None (inferred from 88% identity to aav:Aave_1070)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>GFF4668 Tricarboxylate transport membrane protein TctA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MELIDHLTLGFGVAFTFQNILYALVGCLLGTLIGVLPGIGPVATIAMLLPATYGLPPVAA
LIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTVIDGHQMAKKGRAGPALAAAGLGSFFA
GCVGTLVLAAFAPPLTEVALSFGPAEYFSLMIVGLIGAVVLASGSLVKALAMIVLGLLLG
LVGTDVNSGVARFSFDIPELTDGISFVVIAMGVFGYGEIIHNLSHPEGERQVFTDKVHGL
MPTKEDFKHMLPAVLRGTALGSALGILPGGGALLSAFAAYTIEKKVKLKPGEIPFGKGNI
RGVAGPESANNAGAQTSFIPLLTLGIPPNAVMALMVGAMTIHNIQPGPQVMTSNPELFWG
LIASMWIGNAMLIILNLPLIGMWIKLLAVPYRWLFPAIVLFCAIGVYSTNNNSFDIWMVA
AFGVIGYIFIKLGCEPAPLLLGFILGPMMEEYLRRALLISRGDWSVFVTRPISASLLAVA
VMLLLIVLLPSIKKKREEAFVED