Protein Info for GFF4667 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tricarboxylate transport protein TctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details PF07331: TctB" amino acids 10 to 154 (145 residues), 65.8 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 62% identity to ctt:CtCNB1_0852)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>GFF4667 Tricarboxylate transport protein TctB (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKLASQKDFFSGLMFTIVGITFAIGATNFTVGSAARMGPGYFPLLLGIVLAILGVLVTLQ
SFKSKATDGDPIGKAAWRPLGFIIGANLVFGMLLVGLPSVGFPAFGLIVAIYALVIVAGY
ARPGSSLKESVILATILAAGSYFAFVYALNLQFPVWPAFLTA