Protein Info for GFF4655 in Variovorax sp. SCN45

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF06080: DUF938" amino acids 5 to 201 (197 residues), 223.1 bits, see alignment E=6.3e-70 PF13649: Methyltransf_25" amino acids 32 to 135 (104 residues), 38.9 bits, see alignment E=2.3e-13 PF08242: Methyltransf_12" amino acids 32 to 137 (106 residues), 31.2 bits, see alignment E=6.3e-11 PF08241: Methyltransf_11" amino acids 32 to 138 (107 residues), 26.8 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 46% identical to MTL26_DANRE: Methyltransferase-like 26 (mettl26) from Danio rerio

KEGG orthology group: None (inferred from 81% identity to vap:Vapar_3991)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF4655 SAM-dependent methyltransferase (Variovorax sp. SCN45)
MDDLPFSAAADRNKQPILDVLKRVLGERGAALEIASGTGQHVAWFAAAMSHWTWQPTDAD
AAMLPVIESRLAQAGLPNLRPPVLLDVTAPQWPSRGAPFAERFDAIYCANMLHIAPPSAC
AGLMEGAARHLLPGGLLITYGPYFEEEAPAPSNLAFDQSLRARDASWGIRRLEDVVAQAR
RSGLALRERHAMPANNLLLVFGS