Protein Info for GFF4655 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF17773: UPF0176_N" amino acids 5 to 95 (91 residues), 100.6 bits, see alignment E=5.2e-33 PF00581: Rhodanese" amino acids 118 to 213 (96 residues), 39.4 bits, see alignment E=7e-14

Best Hits

Swiss-Prot: 63% identical to Y1075_ACAM1: UPF0176 protein AM1_1075 (AM1_1075) from Acaryochloris marina (strain MBIC 11017)

KEGG orthology group: K07146, UPF0176 protein (inferred from 68% identity to pna:Pnap_1939)

Predicted SEED Role

"Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF4655 Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPAYLTAALYQFVDLPDHADLREPLLACCEAHGVKGTLLLAREGINGTIAGPEAGVLAVL
AHLRADPRLAQLPHKTSWSDHPPFHRMKVRLKKEIVTLRVPGLDPNQTVGQYVKPQDWNT
LLADPDVLLIDTRNDYEVAIGTFQGAINPNIKTFTELPAWLDAQPALQAAGRKPKVAMFC
TGGIRCEKSTALMKMRGFDEVYHLEGGILKYLEEVPPEQSTWQGDCFVFDERVSVGHGLV
PGPHELCRSCRWPLSAEDKASAHYVKGVSCAHCHDQRSPEEKARLAERQRQVELAEARGE
VHVGARMSEG