Protein Info for GFF4651 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details TIGR02796: protein TolQ" amino acids 5 to 219 (215 residues), 310.3 bits, see alignment E=3.7e-97 PF01618: MotA_ExbB" amino acids 79 to 207 (129 residues), 135.1 bits, see alignment E=5.9e-44

Best Hits

Swiss-Prot: 98% identical to TOLQ_ECO57: Tol-Pal system protein TolQ (tolQ) from Escherichia coli O157:H7

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 98% identity to ecd:ECDH10B_0804)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>GFF4651 MotA/TolQ/ExbB proton channel family protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI
ELSRLYQESQGRRDSLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL
ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI
GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG