Protein Info for GFF4650 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 4-hydroxybenzoyl-CoA thioesterase family active site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family
  • amino acids 1 to 104 (104 residues), 137.1 bits, E=1.7e-44
• PF03061: 4HBT
  • amino acids 1 to 82 (82 residues), 55.5 bits, E=8.7e-19
• PF13279: 4HBT_2
  • amino acids 2 to 109 (108 residues), 50.7 bits, E=3.6e-17
• PF01643: Acyl-ACP_TE
  • amino acids 27 to 111 (85 residues), 24.2 bits, E=3.7e-09

Best Hits

Swiss-Prot: 95% identical to YBGC_ECOLI: Acyl-CoA thioester hydrolase YbgC (ybgC) from Escherichia coli (strain K12)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 95% identity to eco:b0736)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (113 amino acids)

>GFF4650 4-hydroxybenzoyl-CoA thioesterase family active site (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VVYHASYVAFYERARTEMLRHHHFSQQVLLAERVAFVVRKMTLEYYAPARLDDMLEVQTE
ITSMRGTALVFTQRIVNAENTLLNEAEVLIVCVDPLKMKPRALPKSIVAEFKQ