Protein Info for PS417_23785 in Pseudomonas simiae WCS417

Annotation: sulfite oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details amino acids 23 to 26 (4 residues), see Phobius details transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF01794: Ferric_reduct" amino acids 46 to 154 (109 residues), 64.1 bits, see alignment E=6.4e-22

Best Hits

Swiss-Prot: 96% identical to MSRQ_PSEFS: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU5215)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKX3 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PS417_23785 sulfite oxidase (Pseudomonas simiae WCS417)
MRFPIWRIGVFIAAAVWPLFWLYEAWSSVLGPDPGKVLVDRLGLGTLILLLITLTMTPLQ
KLSGWAGWIAVRRQLGLWCFAYVVLHLAAYCVFVLGLDWSQLGVELRKRPYIIVGALGFL
SLLVLAVTSNRYSQRRLGSRWKKLHRLVYGVLGLGLLHMLWIVRADLKEWAIYAFIGALL
LVLRIPPVMRRIPRLIAKKPVSATKA