Protein Info for GFF4641 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 239 to 244 (6 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 353 to 390 (38 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>GFF4641 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
VSRDAVREPTLRAVALTDRGVAVLALLALAAVLAYCGWALDRGFEITDEAYYLLLAMHPD
ATQLYISAQQWATSLLWDITGSLTTFRASGFVVLVGSSVVLGLGILRVAADRGSWPQRLS
VLSVSIICGLLYAITINVSPSYNLLASAGAYAAFGWMLLACGQPSGALRFASLIAAGAAV
GVEFVCKPSAGVATWLLVAICALVLDGTARPRWSAVIFLGAGAVACVAALLLLQTTPGAA
LGAFMGGMDLFRMVQGESILTRLWRYAVEFSIHTATALKVHAFLIAAVILHAFWRRWASL
VLVIAALGHVIVSADYFAYGADQYIKYMQHALILLALLVLSGWALFSTRERWLAAGLVLL
PYSVAMGTGNALFSQVIVSLAPWGGLAALAGYARKNTFQGGAVSRAVLAGFVLMTSVQIL
VYQSKLPYNMSSSMREQDLPVSVGALGLVRVDAPTRQFVQEMDAAVASCGITPETPFLGL
YNIPGAALALNAVPVITPWLNNVAQAEAVLARAPSVVSEAAIAVKMNADGSLPAFPSQMT
DFPSAFRYCGEATYPYGEQRIRIWKGRIPAS