Protein Info for GFF4639 in Variovorax sp. SCN45

Annotation: Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR02623: glucose-1-phosphate cytidylyltransferase" amino acids 1 to 256 (256 residues), 475.5 bits, see alignment E=2e-147 PF00483: NTP_transferase" amino acids 2 to 211 (210 residues), 71 bits, see alignment E=1.2e-23 PF12804: NTP_transf_3" amino acids 3 to 56 (54 residues), 34.3 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 74% identical to RFBF_SALTI: Glucose-1-phosphate cytidylyltransferase (rfbF) from Salmonella typhi

KEGG orthology group: K00978, glucose-1-phosphate cytidylyltransferase [EC: 2.7.7.33] (inferred from 82% identity to pol:Bpro_4009)

MetaCyc: 73% identical to alpha-D-glucose-1-phosphate cytidylyltransferase monomer (Yersinia pseudotuberculosis)
Glucose-1-phosphate cytidylyltransferase. [EC: 2.7.7.33]

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF4639 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) (Variovorax sp. SCN45)
MKAVILAGGLGTRISEETGVKPKPMIEVGGKPILWHIMKIYAAHGVNDFVICCGYKGYVI
KEYFANYFLHMSDVTFDMLGNSMEVHQRNAEPWRVTLIDTGENTMTGGRLKRVAPYVQDE
EHFCFTYGDGVADVDITALIAFHKAQKVAATLTAALPPGRFGALDFDGHKVRSFKEKPKG
DGAMINGGFFVLSPAVLDYIKDDTTVWEHEPLERLAAQGQLAAFKHGGFWQPMDTLRDKT
HLEELWAGGKAPWKVWK