Protein Info for PS417_23710 in Pseudomonas simiae WCS417

Updated annotation (from data): Kynurenine formamidase, bacterial (EC 3.5.1.9)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (ARYLFORMAMIDASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: kynurenine formamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03035: arylformamidase
  • amino acids 6 to 211 (206 residues), 344.8 bits, E=1e-107
• PF04199: Cyclase
  • amino acids 9 to 154 (146 residues), 63.3 bits, E=1.5e-21

Best Hits

Swiss-Prot: 88% identical to KYNB_PSEF5: Kynurenine formamidase (kynB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K07130, (no description) (inferred from 97% identity to pfs:PFLU5199)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• quinoxaline-2-carboxylate biosynthesis (4/10 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (15/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.9

Sequence Analysis Tools

See A0A1N7UF14 at UniProt or InterPro

Protein Sequence (216 amino acids)

>PS417_23710 Kynurenine formamidase, bacterial (EC 3.5.1.9) (Pseudomonas simiae WCS417)
MNPIKTWWDISPPLSTATPTWPGDTPFQEERVWQFGPECPVNVGRITLSPHTGAHVDAPL
HYSADGAPIGEVSLDVYMGPCRVLHCLDSGALVQPHQLEGRVDKLPERVLLRTYPQAPLT
EWDSNFTAVAPQTIELLASLGVRLIGIDTPSLDPQQSKTMDSHNAVARHGMAILEGIVLD
DVPEGDYELIALPLRFANLDASPVRAILRPLKEPTR