Protein Info for PS417_23705 in Pseudomonas simiae WCS417

Updated annotation (from data): Tryptophan 2,3-dioxygenase (EC 1.13.11.11)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (RXN-8665) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03301: Trp_dioxygenase
  • amino acids 17 to 181 (165 residues), 137.1 bits, E=4.9e-44
  • amino acids 210 to 285 (76 residues), 87.1 bits, E=8.1e-29
• TIGR03036: tryptophan 2,3-dioxygenase
  • amino acids 22 to 285 (264 residues), 423.9 bits, E=1.2e-131

Best Hits

Swiss-Prot: 88% identical to T23O_PSEF5: Tryptophan 2,3-dioxygenase (kynA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 99% identity to pfs:PFLU5198)

MetaCyc: 43% identical to tryptophan 2,3-dioxygenase (Streptomyces anulatus)
Tryptophan 2,3-dioxygenase. [EC: 1.13.11.11, 1.13.11.52]

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)

MetaCyc Pathways

• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (15/42 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11 or 1.13.11.52

Sequence Analysis Tools

See A0A1N7UNF9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PS417_23705 Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (Pseudomonas simiae WCS417)
MSQCPFSADYQPPEEWHNAELNFSESMSYGDYLDLGKVLSAQHPLSPDHNEMLFIIQHQT
SELWMKLMLHELKAAREHVRLGELPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIR
PFLGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLNELKVAIATPSLYDEAINLMI
QAGLAIDPKRAERDPTAATVHDESVEAAWREVYRDPSRYWDLYQLAEKFIDLEDSFRQWR
FRHVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSTL