Protein Info for GFF4632 in Sphingobium sp. HT1-2

Annotation: Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 57 to 155 (99 residues), 57.4 bits, see alignment E=1.9e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 59 to 706 (648 residues), 265 bits, see alignment E=8.1e-83 PF00593: TonB_dep_Rec_b-barrel" amino acids 268 to 677 (410 residues), 136.2 bits, see alignment E=3.1e-43

Best Hits

Predicted SEED Role

"Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>GFF4632 Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid (Sphingobium sp. HT1-2)
MRLSLRHLLLSSSFALVVMPHVARAAEADNAAEDASRIVVTAANQPSSSATALSLSVRET
PQSVTIINRERIEDFAITNVNDLLDQTIGINVERVETDRTYFNSRGFDVSNFQVDGVGLP
LAWGIQFGDLDTALFENVEAVRGANAIMTGIGNPSATINYVRKRPLDEFQAKGTAQLGSR
DLWRVEGDVNVPVTDTVSARFIYAHEDRDTHLDYNHINRDVFGAIVAWQVTPDLKATVGY
TRQENDADGVLWGAMPLVFTDGTRIDYARSATTSADWTYWNTKDQNSFGELVYTMGQWTL
SGMFTYKRFQENAKLLYAYGYPDKETGEGVYGMAGIYPSDYKQYLGDFSATGPFSLFGRE
HKLVLGLSYAKSNAKEWENFAEDSALVYPSVYDWGSAQVTEPDYPGEYLAAKYSDELTRL
YGAAHLNFTDQLKGVVGASAMWIKSSGTSYGTDQARDDHKISPYLGLLYDVTPNVTLYAS
YTDIYNPQAEVDANNRKLDPAKGTSIEGGIKSSWFGDRLYATATVFRAKQKGLADYAGTF
GEDGPGKAGGSYYAGVDTTSTGFELEVAGKITDQWTLSGGYTQYDIEDDEGNDTRTWLPT
KSLKLATTYQVPQLNDLKLGAQMRWQNAIKTTLTDVYDGDVYMGDVVVKQKSYAVLDLMA
GIRVVDHLRASVNVKNVTNTKYLGSLMWGQAFYAAPRTAVFTLSVDY