Protein Info for GFF4632 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Endonuclease VIII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF01149: Fapy_DNA_glyco" amino acids 1 to 104 (104 residues), 50.3 bits, see alignment E=5.3e-17 PF06831: H2TH" amino acids 127 to 205 (79 residues), 42.1 bits, see alignment E=1.1e-14 PF06827: zf-FPG_IleRS" amino acids 235 to 263 (29 residues), 28.8 bits, see alignment (E = 1.3e-10)

Best Hits

Swiss-Prot: 100% identical to END8_SALTS: Endonuclease 8 (nei) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K05522, endonuclease VIII [EC: 3.2.2.- 4.2.99.18] (inferred from 98% identity to sty:STY0771)

MetaCyc: 88% identical to endonuclease VIII (Escherichia coli K-12 substr. MG1655)
RXN-21250

Predicted SEED Role

"Endonuclease VIII" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-, 4.2.99.18

Use Curated BLAST to search for 3.2.2.- or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF4632 Endonuclease VIII (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPEGPEIRRAADNLEAAIKGKPLTDVWFAFAQLKPYESQLTGQLVTRIETRGKALLTHFS
NGLTLYSHNQLYGVWRVIDTGEIPQTTRILRVRLQTADKTILLYSASDIEMLTAEQLTTH
PFLQRVGPDVLDARLTPEEVKARLLSPRFRNRQFSGLLLDQSFLAGLGNYLRVEILWQVG
LTGQHKAKDLNEAQLNALSHALLDIPRLSYTTRGQADENKHHGALFRFKLFHRDGEACER
CGGIIEKTTLSSRPFYWCPHCQK