Protein Info for GFF4631 in Variovorax sp. SCN45

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 48 to 178 (131 residues), 59.9 bits, E=2.2e-20

Best Hits

Swiss-Prot: 53% identical to RFBE_YEREN: O-antigen export system ATP-binding protein RfbE (rfbE) from Yersinia enterocolitica

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 96% identity to vpe:Varpa_0791)

MetaCyc: 45% identical to O antigen ABC transporter ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-125 [EC: 7.5.2.14]

Predicted SEED Role

"Teichoic acid export ATP-binding protein TagH (EC 3.6.3.40)" in subsystem Rhamnose containing glycans or Teichoic and lipoteichoic acids biosynthesis (EC 3.6.3.40)

MetaCyc Pathways

• Brucella abortus O antigen biosynthesis (1/7 steps found)
• Escherichia coli serotype O:8 O antigen biosynthesis (1/9 steps found)
• Escherichia coli serotype O:9a O antigen biosynthesis (1/10 steps found)
• H. pylori 26695 O-antigen biosynthesis (1/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.40 or 7.5.2.14

Protein Sequence (233 amino acids)

>GFF4631 ABC transporter (Variovorax sp. SCN45)
MASISLKNVSVSFPIYGAGSASLKKTLAASVTGGRFGKETGVTVVQALSGLNLELRSGDR
LGLIGHNGAGKSTLLRTLAGVYEPSSGEFTRQGSVASLIDPALGIEMDATGVENIMLRGL
VMGMSKKEVDRLTPEICEFSGLGEYVNMPVRTYSTGMMMRLAFSISTSVEADILLMDEWL
SVGDAAFTEKAEKRMRDVVSKSGILVLASHSPELIAKECNRVIHLEHGRIVES