Protein Info for GFF4627 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: O-antigen/lipopolysaccharide transport ATP-binding protein ABC transporter RfbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00005: ABC_tran" amino acids 48 to 180 (133 residues), 65.8 bits, see alignment E=3.2e-22

Best Hits

Swiss-Prot: 46% identical to RFBE_YEREN: O-antigen export system ATP-binding protein RfbE (rfbE) from Yersinia enterocolitica

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to stt:t2153)

Predicted SEED Role

"O-antigen/lipopolysaccharide transport ATP-binding protein ABC transporter RfbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF4627 O-antigen/lipopolysaccharide transport ATP-binding protein ABC transporter RfbE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKISCKNVGVILPIFNSSHRSFKKTFLQAASGGRIGSSNTGIIEVEALKKIDFTLTEGNR
LALIGHNGSGKTTLLRVLAGAYKPTSGKYECIGRVTSLIDPMMGMDGELTGLENIKLRGL
FLGLSKNEIKNITEDVIEFSELGDFIKIPVRTYSSGMVLRLGFSISTAINPEILLMDEWM
SVGDSDFKRKAEMRLNSFISKAGIMVMATHDDELAKSVCNKFIRLEHGEIVSKGGF