Protein Info for GFF4622 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF00892: EamA" amino acids 134 to 264 (131 residues), 43.6 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 58% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 82% identity to vap:Vapar_0781)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF4622 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MLAFAANSLLCRLALQHKGIDAASFGSIRLVAGALMLGLIVRLRARPLASPARADWLAAV
MLFGYVAFFSFAYLSLSAGTGALILFGAVQLTMFGVGLRSGGERFGLLAWLGFVLAVGGL
VYLVSPGIAAPPLLGAVSMAVAGVAWGVYSLRGRGVADPLAATARNFVRAVPLALGLSLI
FAASARVDATGLVLAVVSGALTSGLGYAVWYAALGGLTAMRAATVQLSVPLLAAFGGVLF
LSESITPRLAAASVAILGGIALVLSQKSRSSRP