Protein Info for GFF4619 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 167 (30 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 320 to 345 (26 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 418 to 442 (25 residues), see Phobius details PF02417: Chromate_transp" amino acids 4 to 168 (165 residues), 158.9 bits, see alignment E=6.1e-51 amino acids 244 to 429 (186 residues), 112.6 bits, see alignment E=9.8e-37 TIGR00937: chromate efflux transporter" amino acids 11 to 426 (416 residues), 225.2 bits, see alignment E=1e-70

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 86% identity to vpe:Varpa_4284)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>GFF4619 Chromate transport protein ChrA (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSYWEAFRFWLKLGFISFGGPAGQIAIMHTELVERRRWISERRFLHALNYCMLLPGPEAQ
QLATYIGWLMHRTWGGIVAGALFVLPSLFILIGLSWVYLNFGDVPVVAGIFYGIKPAVTA
LVLHAAHRIGTRALRNPWMWGIAAAAFVAIFAFNTPFPAIVLAAGLIGHFGARRWPQVFA
IGGGHGSKVAGYGPALIDDDTPTPAHACFSKPHLAKVLAAGLGLWLIAMAALLATQGLQG
TLTQMGWFFTKAALLTFGGAYAVLPYVYQGAVDTHQWLSGAQMIDGLALGETTPGPLIMV
VAFVGFVGGWTKEVLGPDALFLGAALAATVVTFVTFLPSFVFILAGGPAVEATHGKLGFT
APLSAITAAVVGVILNLALFFAYHVWWPRGFGASLDLPSVVITLLALVALFRFKMGVLPL
LGACAVAGLIVSLHQIALLALIRMQ