Protein Info for PS417_23630 in Pseudomonas simiae WCS417

Annotation: NADPH quinone reductase MdaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to MDAB_ECOL6: Modulator of drug activity B (mdaB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03923, modulator of drug activity B (inferred from 90% identity to pfo:Pfl01_0718)

MetaCyc: 62% identical to NADPH:quinone oxidoreductase MdaB (Escherichia coli K-12 substr. MG1655)
RXN0-271 [EC: 1.6.5.10]

Predicted SEED Role

"Modulator of drug activity B"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKU2 at UniProt or InterPro

Protein Sequence (196 amino acids)

>PS417_23630 NADPH quinone reductase MdaB (Pseudomonas simiae WCS417)
MKKILLLNGGKKFAHSDGRYNATLHDAAVAVLDRAGIDVNVTHIDAGYDVAEEVAKFLWA
DVIIYQMPGWWMGAPWIVKKYIDEVFTEGHGSLYASDGRTRSDASQKYGSGGLIQGKQYM
LSLTWNAPQQAFDDPTDFFEAKGVDAVYFPFHKANEFLGMTGLPTFLCVDVMKRPAIEAD
VARYEQHLAQVFNFSV