Protein Info for GFF4616 in Xanthobacter sp. DMC5

Annotation: Protein YrdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF14602: Hexapep_2" amino acids 77 to 105 (29 residues), 15.1 bits, see alignment 1.5e-06 PF00132: Hexapep" amino acids 90 to 124 (35 residues), 32.1 bits, see alignment 6.6e-12

Best Hits

Swiss-Prot: 55% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 75% identity to xau:Xaut_0453)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF4616 Protein YrdA (Xanthobacter sp. DMC5)
MPLYALDGIAPELPASGNFWIAPNAVLIGRVIVKEGASIWFGAVLRGDNEPIVVGEGTNI
QENCVLHTDPGYPMTLGPKVTIGHNVTLHGCTVGEGALVGMGATVLNGAVIGDHCLVGSM
ALVTEGKTFEPYSLIVGAPAKVARTLDEAAAERLIATAAGYQHRFPRYAAGLERID