Protein Info for GFF4613 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Di/tripeptide permease YjdL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 462 to 479 (18 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 6 to 466 (461 residues), 270.9 bits, see alignment E=1.3e-84 PF07690: MFS_1" amino acids 22 to 423 (402 residues), 67.3 bits, see alignment E=1.2e-22 PF00854: PTR2" amino acids 77 to 442 (366 residues), 320.1 bits, see alignment E=2.1e-99

Best Hits

Swiss-Prot: 100% identical to DTPD_SALTY: Dipeptide permease D (dtpD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 100% identity to sec:SC0729)

MetaCyc: 88% identical to dipeptide:H+ symporter DtpD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-288

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>GFF4613 Di/tripeptide permease YjdL (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNKQASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYDDNHAYELFSAYCSLVYV
TPILGGYLADKVLGNRMAVMLGAFLMAIGHLVLGASEIAPTFLYLSLAIIVCGYGLFKSN
ISCLLGELYQPEDPRRDGGFSLLYAAGNIGSIVAPIACGYVQEEYSWAMGFALAAIGMLA
GLVIFLCGNRHFTHTTGVNKAVLCARNYLLPNWGWLLILLVAAPLLITVLFWKEWSVYAL
IVATAIGLVVLAKIYRQAQTAKQRKELGLIVTLTLFSMLFWAFAQQGGSSISLYIDRFVN
RDILGYSVPTAMFQSVNAFAVMLCGVVLAWLVKESVSGNRTVRIWGKFALGLGLMSAGFC
ILTLSARWSAAYGHSSMPLMVLGLAVMGFAELFIDPVAMSQITRIDIPGVTGVLTGIYML
LSGAIANYLAGVIADQTSQSAFDASGAVNYAINAYVDVFEQITWGALACVGVVLLIWLYQ
SFKFKSRALAVES