Protein Info for GFF4612 in Variovorax sp. SCN45

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 11 to 198 (188 residues), 199.5 bits, see alignment E=5.9e-63 PF08659: KR" amino acids 14 to 175 (162 residues), 61.3 bits, see alignment E=1.7e-20 PF13561: adh_short_C2" amino acids 17 to 230 (214 residues), 147 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 50% identical to Y432_LISMO: Uncharacterized oxidoreductase Lmo0432 (lmo0432) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_0808)

MetaCyc: 39% identical to S-1-(4-hydroxyphenyl)-ethanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF4612 Short-chain dehydrogenase/reductase SDR (Variovorax sp. SCN45)
MTSVQDNIKGKVAIVTGASSGLGESTARHLAARGARVVLAARRTERLEKLVAEIREAGGE
AIAVATDVAKRADLEKLAVATVEAFGRIDVLVNNAGVMPLSPIEKLKVDEWDRTIDVNIK
GVLYGIAAVLPRMQAQGSGHIVNIASIAGLKVFTPIGTVYSATKYAVRAISEGLRVEMGN
SGVRVTVVSPGAVESELKFGSTDAESAAGVKAFYEANQIPADSVARAVVYAVEQPADVDI
NEVVLRPVSQEF