Protein Info for GFF4610 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 524 to 549 (26 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 558 (558 residues), 931.4 bits, see alignment E=9.4e-285 PF03814: KdpA" amino acids 12 to 556 (545 residues), 810.1 bits, see alignment E=3.6e-248

Best Hits

Swiss-Prot: 100% identical to KDPA_SALTY: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to stm:STM0706)

MetaCyc: 85% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>GFF4610 Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAAQGFLLIASFLLILLVLAKPLGSGLARLIAAVPLPGVAGIERILWRTLGITDHEMNWR
QYLLALLTLNLLGLGILFCLLFWQEWLPLNPQRLPGLSGDLALNTAVSFVTNTNWQAYSG
ESTLSYFSQMAGLTVQNFLSAATGIAVVFALIRAFTRQNVHTLGNAWQDLVRITLWILFP
VALIIALFFIQQGVPQNLSAYQPITTLEGAKQLLPMGPVASQEAIKMLGTNGGGFFNANS
SHPFENPTALTNLAQMLAIFLIPAALCFAFGEAAGDRCQGRALLWAMSFIFVVCVAVVMW
AEVQGNPHLLAAGADSSVNMEGKETRFGVLASSLFAVVTTAASCGAVNAMHDSFTALGGM
VPMWLMQIGEVVFGGVGSGLYGMLLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKMTALA
ILVTPMLVLLGSALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPF
WNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKVQPASQGTLATHGALFIGLLIGTVLLVGA
LTFIPALALGPVAEHFSLP