Protein Info for GFF4607 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 transmembrane" amino acids 375 to 396 (22 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details amino acids 453 to 474 (22 residues), see Phobius details PF02702: KdpD" amino acids 1 to 206 (206 residues), 320.5 bits, see alignment E=1.1e-99 PF13493: DUF4118" amino acids 379 to 484 (106 residues), 105.2 bits, see alignment E=3.9e-34 PF13492: GAF_3" amino acids 546 to 620 (75 residues), 31.3 bits, see alignment E=6.1e-11 PF00512: HisKA" amino acids 640 to 706 (67 residues), 48.4 bits, see alignment 2e-16 PF02518: HATPase_c" amino acids 752 to 857 (106 residues), 96.1 bits, see alignment E=4.5e-31

Best Hits

Swiss-Prot: 90% identical to KDPD_ECOLI: Sensor protein KdpD (kdpD) from Escherichia coli (strain K12)

KEGG orthology group: K07646, two-component system, OmpR family, sensor histidine kinase KdpD [EC: 2.7.13.3] (inferred from 91% identity to cko:CKO_02466)

MetaCyc: 90% identical to sensor histidine kinase KdpD (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (870 amino acids)

>GFF4607 Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LKIFFGACAGVGKTWAMLAQAQRLRAQGLDVVIGVVETHGRKETAALLDGLTILPPKRHS
HRGRQIREFDLDAALARRPALILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNV
QHLESLNDVVSGVTGIQVRETVPDPFFDAADEVVLVDLPPDDLRQRLNEGKVYIAGQAER
AIEHFFRKGNLIALRELALRRTADRVDDQMRAWRAHPGEEKVWHTRDAILLCIGHNTGSE
KLVRTAARLASRLGSVWHAVYVETPTLHRLPEKQRRAILSALRLAQELGAETATLSDPAE
EKAVVRYAREHNLGKIVMGRPASRRWWRRDAFADRLARRAPDLDQVIVALEEPPARALAQ
TPDNRPFKEKWRGQIQGCLVAVALCAITTLIAMQWLVTFDAANLVMLYLLGVVVIALLYG
RWPSVVATVINVASFDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARV
ARYREQRTRHLYEMSKALAVGRSEHDIAATSERFIASTFQARSQILLPDANGKLLPLTHQ
QGMTPWDDAIARWSFDKGQPAGAGTDTLPGVPYQILPLKSADKTYGLAIVEPGNLRQLMV
PEQQRLLETFTLLVANALERLTLTASEEQARLASERESIRNALLAALSHDLRTPLTVLFG
QAEILTLDLASAGSPHARQASEIRQHILNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEV
VGSALQMLEPGLLHPITLSLPQQLTLIHVDGPLFERVLINLLENAVKYAGPQASIGIDAA
VKDDRLQLDVWDNGPGIPAGQEQKIFDKFARGNKESAVPGVGLGLAICHAIVEVHGGTLT
AYNRPQGGACFRVTLPQGKPPELDDFHEDM