Protein Info for PS417_00235 in Pseudomonas simiae WCS417

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00702: Hydrolase" amino acids 5 to 178 (174 residues), 73 bits, see alignment E=8.8e-24 PF13419: HAD_2" amino acids 8 to 186 (179 residues), 100 bits, see alignment E=3.6e-32 PF12710: HAD" amino acids 8 to 173 (166 residues), 45.7 bits, see alignment E=2.1e-15 PF13242: Hydrolase_like" amino acids 153 to 210 (58 residues), 36.6 bits, see alignment E=6.8e-13

Best Hits

Swiss-Prot: 71% identical to 5NTD_PSEAE: 5'-nucleotidase (PA0065) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 94% identity to pfs:PFLU0046)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAS0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PS417_00235 HAD family hydrolase (Pseudomonas simiae WCS417)
MTLHYQTVLFDLDGTLTDPREGITRSIQYALGKLGIDEPDLTQLEHFIGPPLLQAFMQFY
GFDEAKAWEAVNFYRERFKVTGLYENRVFEGVMPLLEDLSGQGRQLYVATSKPWVFAREI
ARHFDFAKHFKVIYGSELDGTRTNKVELIAHLMSEEGLDPATTLMIGDRKHDLIGAHSNG
LDSAAVGYGFGSFEELNAEAPTWHFETLAEMHQAFMQRS