Protein Info for GFF4598 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, permease/ATP-binding protein mlr7818

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 45 to 318 (274 residues), 151 bits, see alignment E=8.4e-48 PF00005: ABC_tran" amino acids 383 to 532 (150 residues), 117.7 bits, see alignment E=9.2e-38

Best Hits

Swiss-Prot: 47% identical to AB23B_ARATH: ABC transporter B family member 23, mitochondrial (ABCB23) from Arabidopsis thaliana

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 95% identity to vpe:Varpa_0847)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>GFF4598 Efflux ABC transporter, permease/ATP-binding protein mlr7818 (Variovorax sp. SCN45)
MRRGGEALTPSHTVSGHPPERGDRSDWATLRRLFPYLWQYKWRVIAALTFMVGAKVANVG
VPVLLKNLVDTMTPKPDMAQALLIVPIGLLLAYGLLRFSTALFGELRELIFAKATEGTAR
QIALEVFGHLHSLSLRFHLERQTGGMTRDIERGTRGVHSLISMSLYSIVPTIIELVLVLC
ILGVKFDSLFVWITLAALVLYITFTVTVTEWRTQFRKTMNELDSMAQSRAVDSLLNYETV
KYFNNEEFEAKRYDASLDRYRKAAIKSQRTLSMLNTGQQALIAISLVLMLWRATSGVVDG
RMTLGDLVMVNAFMIQLYIPLNFLGVIYREIKQSLTDLDKMFVLMEKEREVRDAPEAQPL
AGTDSTVRFEDVSFAYEPARPILKHVSFEIPAGKTVAVVGPSGSGKSTLARLLYRFYDVQ
HGHITIGGEDIRDVTQSSVRRAIGIVPQDTVLFNDTVEYNIAYGRPGATREEVEAAARAA
RIHDFISATPKGYETTVGERGLKLSGGEKQRVAIARTLLKNPPIVIFDEATSALDSANER
AIQSELKSAAQDKTTLVIAHRLSTVVDAHEILVLESGVIVERGTHAELLAKQGRYAQMWA
LQKSEATPLM