Protein Info for PS417_23520 in Pseudomonas simiae WCS417

Annotation: cysteine biosynthesis protein CysZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 68 to 96 (29 residues), see Phobius details amino acids 146 to 175 (30 residues), see Phobius details amino acids 210 to 238 (29 residues), see Phobius details PF07264: EI24" amino acids 11 to 227 (217 residues), 176.4 bits, see alignment E=3.7e-56

Best Hits

Swiss-Prot: 98% identical to CYSZ_PSEFS: Sulfate transporter CysZ (cysZ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06203, CysZ protein (inferred from 98% identity to pfs:PFLU5163)

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBW9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_23520 cysteine biosynthesis protein CysZ (Pseudomonas simiae WCS417)
MPAPALSGPQYLREGLKLVLSPSLRLFVLLPLAINLVLFVGLIYFAGHQFSLWVDHLMPT
LPSWLGFLNYLLWPLFVVLVVLMVFFTFTMLANIIAAPFNGFLSEKVEVVVRGTDDFPAF
SWGELIAMVPRTLAREMRKLGYFLPRAIGLFILSFIPVVNLIAAPLWLLFGVWMMAIQYI
DYPADNHKLGWNEMLAWLRQKRWQSMSFGGIVYLVLLVPVVNLLMMPAAVAGATLFWVRE
QGAEAMAQQQKVTQS