Protein Info for GFF4593 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 45 to 262 (218 residues), 81.5 bits, see alignment E=7.2e-27 PF12974: Phosphonate-bd" amino acids 63 to 244 (182 residues), 31.2 bits, see alignment E=2.2e-11 PF09084: NMT1" amino acids 87 to 194 (108 residues), 26.1 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K10001, glutamate/aspartate transport system substrate-binding protein (inferred from 74% identity to ctt:CtCNB1_4182)

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF4593 Glutamate/aspartate ABC transporter, substrate-binding protein GltI (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MKKQLLALAVTAFVATGAFAQATDTLAKIKERGAVNLGVRDSSGLAYTLGGGKYVGFHTE
MAERIIDDLSKDVGKPLKIDYQVITSQNRVPLVQNGTIDFECGSTTNNTARQKDVDFAYT
TYVEEVRILTKANSGINGIADLKGKVVATTTGTTSVQTLRKNKRAEGLDFKEVMGKDHAD
SFLLLESGRADAFVMDGSILAANAAKSKNPKDFKMVGEVLSVEPIACMLPKGDAKLKKAI
DDSIVRQIKDGSLAKLYDKWFTQPIPPNNVNLNMPVSEGTKAAWANPNDKPMEAYAPK