Protein Info for GFF4592 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, permease protein GltJ (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 34 to 133 (100 residues), 69.9 bits, see alignment E=1.1e-23 PF00528: BPD_transp_1" amino acids 54 to 239 (186 residues), 51.2 bits, see alignment E=6.6e-18

Best Hits

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 72% identity to adk:Alide2_0650)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF4592 Glutamate/aspartate ABC transporter, permease protein GltJ (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MLNLDMSVFCQDTLTNEVVASCFAHGADQTYLQWMLNAWGWTVSVALTALLVALVVGSII
GTLRTLPDSPWLVRFGNAWVELFRNVPLLVQVFIWYFVLPKMIPAMRDLPPFVLVVCALG
FFTSARIAEQLRSGIQALPRGQRYAGMAVGFTTPQYYRFVLLPMAYRIIMPPLTSESMNI
FKNSSVAFAVSIPELTQFYLQAGEETSAQIPIYIGVVILYVISAMLINRIMTFIERKVRV
PGFVAAGGTGGH