Protein Info for GFF4592 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: TcuC: integral membrane protein used to transport tricarballylate across the cell membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 78 (27 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 224 (204 residues), 95 bits, see alignment E=5e-31 amino acids 227 to 415 (189 residues), 27.4 bits, see alignment E=1.6e-10 PF07690: MFS_1" amino acids 22 to 383 (362 residues), 105.5 bits, see alignment E=2.9e-34 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 23 to 413 (391 residues), 476.9 bits, see alignment E=2.7e-147

Best Hits

Swiss-Prot: 100% identical to CITA_SALTI: Citrate-proton symporter (citA) from Salmonella typhi

KEGG orthology group: K03288, MFS transporter, MHS family, citrate/tricarballylate:H+ symporter (inferred from 100% identity to seg:SG0686)

MetaCyc: 100% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"TcuC: integral membrane protein used to transport tricarballylate across the cell membrane" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF4592 TcuC: integral membrane protein used to transport tricarballylate across the cell membrane (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAQHTPATSRAGTFGAILRVTSGNFLEQFDFFLFGFYATYIARTFFPAESEFASLMLTFA
VFGSGFLMRPVGAIVLGAYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYQTIGLAAPALV
LLGRLLQGFSAGVELGGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYSLNITL
GHDAISEWGWRIPFFIGCMIIPLIFVLRRSLQETEAFLQRKHRPDTREIFATIAKNWRII
TAGTLLVAMTTTTFYFITVYTPTYGRTVLNLSARDSLIVTMLVGVSNFIWLPIGGAISDR
IGRRAVLMGITLLALITTWPVMQWLTAAPDFTRMTLVLLWFSFFFGMYNGAMVAALTEVM
PVYVRTVGFSLAFSLATAIFGGLTPAISTALVKLTGDKSSPGWWLMCAALCGLAATAMLF
VRLSRGYIAAENKA