Protein Info for GFF459 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane protein A precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 36 to 80 (45 residues), 33.8 bits, see alignment 3.3e-12 PF13488: Gly-zipper_Omp" amino acids 37 to 85 (49 residues), 42.2 bits, see alignment 8.5e-15 PF00691: OmpA" amino acids 115 to 210 (96 residues), 84.5 bits, see alignment E=8.1e-28

Best Hits

Swiss-Prot: 95% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to stm:STM3645)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>GFF459 Outer membrane protein A precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRG
KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS
ATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQG
VDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ