Protein Info for GFF4588 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 288 (281 residues), 123.4 bits, see alignment E=5e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 76% identity to mpt:Mpe_A1771)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF4588 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEFFIISMLNGLSYGLLLFMLSSGLTLIFSMMGVLNFAHASFYMLGAYVGYTVAQFVGFW
PALLIAPIVVGLLGAAFERQCLRKVHKYGHVPELLVTFGLSYVIVELVQLIWGRIAVEFR
PPEELRGPVFTLINHSVDGLRMVWGAAPPELCSAADAAIRVVCSPFPATRGFMMLVAIVM
LASVWLLLTRTRIGLVIQAALTHPDAVESLGHNVPRVFMLVFGAGSALAGLAGVIGGSTF
LTEPAMAATVGSVIFVVVVVGGMGSLSGAFVASILIGVIQTFAVAFEYSLATLAQQIGLP
LPEAVANNSYIKLTLSQVAPILPYLFLVLILIFRPRGLLGKREG