Protein Info for PS417_23465 in Pseudomonas simiae WCS417

Annotation: flavodoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00258: Flavodoxin_1" amino acids 5 to 141 (137 residues), 76.3 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 82% identical to Y3435_PSEAE: Uncharacterized protein PA3435 (PA3435) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06205, MioC protein (inferred from 95% identity to pfs:PFLU5152)

Predicted SEED Role

"Hypothetical flavoprotein YqcA (clustered with tRNA pseudouridine synthase C)" in subsystem Flavodoxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3Q4 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PS417_23465 flavodoxin (Pseudomonas simiae WCS417)
MKVAILSGSVYGTAEEVARHAADILNAAGFEAWHNARASLADVQAFAPDAFLAVTSTTGM
GELPDNLQPLYSGIRDQLPAAWRGLPGAVIGLGDASYGDTFCGGGEQMRELFSELGVREV
LPMLRLDASESVTPEADAEPWLAELVTALRG