Protein Info for PS417_23455 in Pseudomonas simiae WCS417

Annotation: LrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details PF03788: LrgA" amino acids 19 to 111 (93 residues), 80.4 bits, see alignment E=3.9e-27

Best Hits

Swiss-Prot: 34% identical to CIDA1_BACAN: Holin-like protein CidA 1 (cidA1) from Bacillus anthracis

KEGG orthology group: K06518, holin-like protein (inferred from 80% identity to pfl:PFL_0957)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UNB7 at UniProt or InterPro

Protein Sequence (123 amino acids)

>PS417_23455 LrgA (Pseudomonas simiae WCS417)
MKRFTRLLIELIALLAIYLLGCQLAVWLTLPIPGGVVGLGLLLATFASGLIKPAALQLGA
GVLMAEMLLFFIPALMSLLDYGGLLRNDGWRILLVIGLSTLAVMLVTAFTVELVCRWKLR
HEV