Protein Info for GFF4582 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details PF04290: DctQ" amino acids 46 to 175 (130 residues), 94.1 bits, see alignment E=3.3e-31

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_0859)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>GFF4582 TRAP-type C4-dicarboxylate transport system, small permease component (Variovorax sp. SCN45)
MTTPPESGPTLDAASPIPPDIEAADEPTKVPLAIEDWLTVIIMGALALITFANVLVRYFT
DSSFAWTEEFSVFLMIMLALVAGSAAVARDRHIRIEYFSESGSMARRKRLAQFGALTIAI
LFTLIGALSIRMVWDDYRFEETTPGIGLPAWWYSIWLPIVSFAIALRAIGLMVRRGRKTN
YGTDGSERKTKKKSKGDAS