Protein Info for GFF4582 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 312 to 411 (100 residues), 76 bits, see alignment E=6.5e-25 PF00072: Response_reg" amino acids 437 to 550 (114 residues), 81.6 bits, see alignment E=9.3e-27 amino acids 573 to 686 (114 residues), 87 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: None (inferred from 44% identity to rpf:Rpic12D_5059)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (825 amino acids)

>GFF4582 Sensory box histidine kinase/response regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MMKFLRGLLDQHRQYHEGDPQMLLYAGLLGTVAYPLFYLLRFAKNEPVYDDLALRSLAFA
ASLLLLLRYRWPRSLVPYFFPYSWVTVTLTLPFFFVFTSLKNGGGPAAVGNTLMAVFFVM
LITDRRNMILMLLIGFSAAFGVYWVTDPNPTLPYDYVARVPILLLTLVGGSLFKLCVERS
TAERVRQAYASLAGSIAHEMRNPLGQLKYTLENIEKVLPPPTTKAQDQVLTQEDQDALYR
HIAQGELSVQRGLQVVSMTLDEVHQKPLRSDSFMLLSAGDSCRKAVEEFGYEDASHRERV
SLHVERDFVFHGDETAFLFVLFNLIKNALAYPQLQLCITVDDQQVRVSDNGPGIPPAVLE
RLFQPFHTSGKKGGTGLGLSYCQRVMQAFGGRISCLSVLGESTCFTLEFPPVTAAESEAL
RNATLLEARGLLESRRVLVVDDQTMLRTVTRQRLVSTGATVDECADGEQALSMLARTHYD
LMVLDLNMPGLDGYEVVKLIRAGHPGIDRSLRIVAHSSEPASVARVKTRKAGMDGFVPKP
CEQSVLLHALCRALQTASATDMDGALQIAGRSVLLADDIAFNRKAVATYLRHAGVVVTEA
GSGQEALALLESMAHCDAILLDIEMPGMNGLEVASAIRASGMACRNAPIVALTAHSGADM
VAMARKAGMSDLLVKPVDMTSLYSKLREWLAPPAADSVPVLSPAHASTATVPGLLDINRL
QNYHRLGVLDELLADLLPVIKQNVGDVEVAASANDLAGCRFALHSLIGMSGEAGAWALCQ
LARRIYEPLSESQWPSQADWIESLRALARESYRALHEYSIAARMS