Protein Info for GFF4579 in Xanthobacter sp. DMC5

Annotation: O-acetylserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 96 to 112 (17 residues), see Phobius details TIGR01136: cysteine synthase" amino acids 24 to 324 (301 residues), 429.3 bits, see alignment E=8e-133 PF00291: PALP" amino acids 24 to 312 (289 residues), 247.6 bits, see alignment E=8.7e-78 TIGR01139: cysteine synthase A" amino acids 24 to 324 (301 residues), 445.8 bits, see alignment E=7e-138

Best Hits

Swiss-Prot: 63% identical to CYSK_MYCBO: O-acetylserine sulfhydrylase (cysK) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 91% identity to xau:Xaut_0075)

MetaCyc: 57% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF4579 O-acetylserine sulfhydrylase (Xanthobacter sp. DMC5)
MAQPAAKIVSSAPLVGRGRVYDSITETIGNTPLVRLKRLPELRGAKADILAKLEFFNPIS
SVKDRIGVAMIDAMEAAGALDADTVLVEPTSGNTGIALAFVAAARGYRLILVMPESMSIE
RRKMLTLLGAELVLTPANLGMKGAVSRAEQIIAEMPKAVMPQQFKNKANPEVHRRTTAEE
IWNDTNGKVDAVVAGVGTGGTITGIGQVLKPRKASLKMIAVEPEDSPVLSGGPPGPHKIQ
GIGAGFVPEVLDRSIIDEVVTVGNQTAFDTARALARYEGIPGGISSGAAVAAALELAVRD
DMAGKTIVAIVPSFAERYLSTALFEGL