Protein Info for GFF4577 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Bacterial luciferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 9 to 330 (322 residues), 424.8 bits, see alignment E=1.1e-131 PF00296: Bac_luciferase" amino acids 14 to 301 (288 residues), 129 bits, see alignment E=1.3e-41

Best Hits

Swiss-Prot: 54% identical to YVBT_BACSU: Uncharacterized protein YvbT (yvbT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 81% identity to pna:Pnap_1447)

Predicted SEED Role

"Bacterial luciferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF4577 Bacterial luciferase family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKNLSDIRLSMLDLVAVREGGTVADALAVALRTAQHAESLGFTRYWLAEHHNMSGIASSA
TAVLIGHIAGGTKRMRIGSGGVMLPNHAPLVVAEAFGTLAELYPGRIDLGLGRAPGTDPH
TMRALRRDRVETEADFPRDVAELQHLLGPASPGQRLIANPGAGTNVPIWLLGSSLFSAQL
AAERGLPYAFASHFAPRLLLQALNVYRTHFQPSATLAEPYAVVGVPLVAAPTDEEAEYLA
SSTYQRVLGILTGKRGQLPPPVKGFMQGLHAQEQAAIADFLAAAVIGGPETVRAGLQSLA
QVTQADEFMIVSDLFDPALRLRSLSIAAEAMATQADTQAA