Protein Info for GFF4576 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02130: YbeY
  • amino acids 22 to 144 (123 residues), 140.5 bits, E=1.9e-45
• TIGR00043: rRNA maturation RNase YbeY
  • amino acids 40 to 144 (105 residues), 126 bits, E=3.5e-41

Best Hits

Swiss-Prot: 100% identical to YBEY_SALTY: Endoribonuclease YbeY (ybeY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 99% identity to seg:SG0672)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Protein Sequence (157 amino acids)

>GFF4576 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQVILDLQLACENHAGLPDEAQFQRWLDGVIPQFQEEAEVTIRLVDEAESHDLNLTYRG
KDKPTNVLSFPFEAPAGIEMPLLGDLIICRQVVEQEAQEQSKPLEAHWAHMVVHGSLHLL
GYDHIDDDEAEEMESLETEIMLAMGYEDPYIAEKIAE