Protein Info for GFF4569 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 92 to 117 (26 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details PF05661: DUF808" amino acids 28 to 308 (281 residues), 362.4 bits, see alignment E=8.3e-113

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 70% identity to dac:Daci_4843)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF4569 Membrane protein, putative (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAGTSLLALIDDIATILDDVALMTKVAARKSAAVADDVAAMTQLAAKKTAGVLGDDLALN
AQQVTGVKADRELPVVWAVAKGSLMNKAILVPSALVISVIAPWAITPLLMLGGLFLCFEG
AEKLWHAFGPHKAEDAAHREELVEAVANENVDLVAFEKQKIKGAVRTDFILSAEIIVITL
GTVAAVGMGQRIAVLVGISLIMTVGVYGLVAGIVKLDDLGLHLNRQAAAWKQSLGRGILA
AAPWLMKTLSIVGTAAMFLVGGGILVHGIPALGHGIEAFAATLGWIGSLASSLAGALAGL
VAGGVVLALVSVGKRLRGAAKPA