Protein Info for GFF4568 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details PF17152: CHASE8" amino acids 44 to 143 (100 residues), 76.5 bits, see alignment E=2.5e-25 PF00672: HAMP" amino acids 181 to 230 (50 residues), 24.9 bits, see alignment 3e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 243 to 405 (163 residues), 131.8 bits, see alignment E=9.9e-43 PF00990: GGDEF" amino acids 247 to 403 (157 residues), 136.5 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: None (inferred from 45% identity to pba:PSEBR_a686)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF4568 hypothetical protein (Sphingobium sp. HT1-2)
MAEPSPTAMPTLRQLLARAHLRLILFAVLMAGLTLTVTGVTVIRGYAARNLTLIAQTVAY
TVEPALVFEDVDAARRGIATVAASESVRSVELHDRDGRLIAAWNRPDRGMAGNLSRIVDA
LFWPSPVRVPVHHGPVVVAEVQVFGDAGGLGRYILSGVATALACLGLTIVATQLLARRLQ
RDVTGPLAHIAQVAHAVRSDRQFDQRVPAAGIHEIDQFARDFNALLDELDEWHTGILNEN
RILERQATRDPLTGLGNRAMFERELAATMAQADEGDTSFAVIYVDVNRFKQVNDSHGHDA
GDVMLIVIAARLRMALRPGDMAFRLGGDEFALILAAGATRSEADQMSAQIGAGMTQPIML
PSGVSIRSSLSIGSALYPQDSVDPRALLRHADAAMYAAKARGDGRN