Protein Info for PS417_23375 in Pseudomonas simiae WCS417

Annotation: cytochrome C oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 16 to 111 (96 residues), 117.8 bits, see alignment E=1.2e-38 PF03626: COX4_pro" amino acids 24 to 96 (73 residues), 59.9 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 69% identical to CYOD_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas putida

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 100% identity to pfs:PFLU5137)

MetaCyc: 67% identical to cytochrome bo terminal oxidase subunit IV (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6D1 at UniProt or InterPro

Protein Sequence (113 amino acids)

>PS417_23375 cytochrome C oxidase (Pseudomonas simiae WCS417)
MANAHSHDHDSHDASHGSVKSYAIGFILSVILTLIPFGLVMYPTLPKSITLMIVLAFAVI
QVLVHLVYFLHLDRSKEQRDNVIAFVFAGLVILLLVGLSIWIMFSIHTFMMAK