Protein Info for GFF4561 in Variovorax sp. SCN45

Annotation: Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6 (EC 3.2.2.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR03915: probable DNA metabolism protein" amino acids 10 to 244 (235 residues), 213 bits, see alignment E=5.4e-67 PF13566: DUF4130" amino acids 86 to 243 (158 residues), 130 bits, see alignment E=7.3e-42 TIGR03914: uracil-DNA glycosylase family domain" amino acids 246 to 475 (230 residues), 267.8 bits, see alignment E=8.1e-84 PF03167: UDG" amino acids 316 to 474 (159 residues), 108.9 bits, see alignment E=2.3e-35

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 80% identity to vpe:Varpa_0886)

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>GFF4561 Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6 (EC 3.2.2.27) (Variovorax sp. SCN45)
MRVRLDNPVDFDAFRREARRLLANGVPPDHVEWSDGAQGEGGAGLFADTPAGEGLPATEP
ASAARQPVPASFLALCADVILHREPQRLALMYRLLWRLAHEPALRHDPLDADMLQARQMA
KAVHRDIHKMRAFVRFTRVEGEQGERHVAWFEPDHRIVEANAPFFARRFAQMRWAILTPE
RCVAWDGQALTFREGADRREKPPPDAGEQLWLVYYEHIFNPARLKLAMMRREMPARYWHN
LPEAALIGPLAEAAQARSQSMIDAPATPARRIRAPVPLHPLPADRAAPASLDELRAAAHA
CRDCPLGALATQAVCGEGPPGAARMLVGEQPGDQEDLAGRPFVGPAGQLLDRAMAQLGQP
RGSVYLANAVKHFKYELRGKRRIHKTAGQREAEACAHWLDSEIALVRPQALVALGATAAR
ALLGRPVAVQAERGAWLHERADGRPVFVTLHPSALLRLPDAERPAAYDRWLADLSDAFAS
PQGDSRDIHSAAAHVLAPWTGVIARGR