Protein Info for GFF4560 in Sphingobium sp. HT1-2

Annotation: ATP synthase gamma chain (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR01146: ATP synthase F1, gamma subunit" amino acids 1 to 294 (294 residues), 327.1 bits, see alignment E=6.5e-102 PF00231: ATP-synt" amino acids 3 to 294 (292 residues), 326 bits, see alignment E=1.4e-101

Best Hits

Swiss-Prot: 72% identical to ATPG_SPHAL: ATP synthase gamma chain (atpG) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02115, F-type H+-transporting ATPase subunit gamma [EC: 3.6.3.14] (inferred from 90% identity to sch:Sphch_0067)

Predicted SEED Role

"ATP synthase gamma chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF4560 ATP synthase gamma chain (EC 3.6.3.14) (Sphingobium sp. HT1-2)
MASLKELKLRIGSVKSTQKITKAKQMVAAAKLRKAQAAAEAARPYSERLEAVVASLATKI
AGGSGEGASPLLAGTGKDEVHLLVVANSDRGLAGAFNANIVKAALAKARALELDGKKVLF
YLIGRKGRPVINRTYPGKIVANYDTTGAKEPGFAQAQAVAQELSQMFLDGKFDVAHLFYS
RFKSALAQIPTEQQIIPVKIPADADRNAIAATVEYEPSEEAILDDLLPRNVTVQLFKALL
ENNASEQGASMTAMDNATRNAGDLINKLTIQYNRSRQAAITTELVEIISGAEAL