Protein Info for GFF4557 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 239 to 249 (11 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 374 to 391 (18 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>GFF4557 hypothetical protein (Sphingobium sp. HT1-2)
MTALAFTAPAQDEPAFTPPANGSPSWLAHQLPSGWLIAALLSWLGLDQLLLWRFLDIMPV
WAYPLGILLIVGLSFATVRAMPDQRGPTVATLIACMAVALILLILGGEGRFFYANIDWQV
RLAALNDMRINPWPFVYTARAEPDVLRFPIGMFLVPALAGKAWGAGAGDIALLLQNAVML
AMLLAMGSTLFNQRRERTVALTILVGFSGLDALGRILFRGGLSDHMENWAYLQYSSTITL
AFWVPQHAMSGWIGATGYLLWRDGKASLAQFLTLLPLTALWSPLGLMGAMPFAALAGMRA
LIARDIRPRDIGLPALALLLATPGLLYLGAANDDVGARLNALPPLQWGLFELLEVLVYAI
PVALIAHARRFGMDTLVLLTLWLLAIPFVQIGSSTDFMMRGSVTALTILAVMLVDLLLVP
SRARLFLIVALAVGALTPLHEIRRAVSHPAASEVRCSFFMAWRQSFWFQPMGTYLAPISH
MPALVRPTNPYRASAAEPARCWDGQWYHPDGRYGPPHSGGQDGVERKAKGQAHTPQQVPL
GREDMAQQSIQ